PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007989P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 284aa    MW: 31544.8 Da    PI: 7.0038
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007989P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.4e-334296155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt +LHerFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  MELO3C007989P1 42 KPRLRWTADLHERFVDAVTQLGGAGKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 96
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-313997IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-234297IPR006447Myb domain, plants
SuperFamilySSF466898.24E-174298IPR009057Homeodomain-like
PfamPF002492.5E-74495IPR001005SANT/Myb domain
PfamPF143799.4E-16137182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MFPRLVNPDG DIQIHGPRGS VASDLTHTHR GDPCLVLTSD PKPRLRWTAD LHERFVDAVT  60
QLGGAGKATP KAIMRTMNVK GLTLFHLKSH LQKYRLGKQS GKDMGEASKD GAYLLESPST  120
NNFSPDLPIS EMADGYEVKE ALRAQMEVQS KLHLQVEAEK HLQIRQDAER RYLAMLERAC  180
KMLADQFIVG AVSDSDSKKS EGQDRKSPRS TSIDPLGFYT TQSQEMERVN GTEEVQANLP  240
CQRADCSTES CLTSNESPGG LAMENLLLQA RKTWLTWIQQ LHL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011658095.10.0PREDICTED: myb family transcription factor APL-like isoform X2
SwissprotQ9SAK54e-47APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0A0KL090.0A0A0A0KL09_CUCSA; Uncharacterized protein
STRINGGLYMA09G02030.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.15e-63G2-like family protein